PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g001300.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 25495.8 Da    PI: 9.1607
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g001300.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89.4e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELS+LC+aeva+iifs++gklye++s
  Sopen04g001300.2  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLYEFCS 59
                      79***********************************************96 PP

2K-box935e-31821739100
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       ++++++++ +qe+ kLk+++e Lq++qRh+lGedL++L+ k+L+qLe+qL++sl+ iRs++++ +l+q+++lq+ke++l e+n++L++klee
  Sopen04g001300.2  82 QSSKDSQNNYQEYMKLKARVEVLQQSQRHILGEDLGQLNTKDLEQLERQLDSSLRLIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKTKLEE 173
                       678889***********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.081161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.18E-42278No hitNo description
SuperFamilySSF554551.7E-33284IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.9E-2683171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.38687177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSILCE AEVALIIFSN RGKLYEFCST  60
SSMSDTLERY HRCNYGDLET GQSSKDSQNN YQEYMKLKAR VEVLQQSQRH ILGEDLGQLN  120
TKDLEQLERQ LDSSLRLIRS RRTQNMLDQL SDLQQKEQSL LEINRSLKTK LEENSVAHWH  180
ITGEQNIQFR QQPAQSEGFF QPLQCNTNIV PNRGEFRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D6e-26751731103Developmental protein SEPALLATA 3
4ox0_C6e-26751731103Developmental protein SEPALLATA 3
4ox0_B6e-26751731103Developmental protein SEPALLATA 3
4ox0_A6e-26751731103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754432e-98HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072987.11e-160PREDICTED: MADS-box protein CMB1 isoform X2
SwissprotQ396856e-98CMB1_DIACA; MADS-box protein CMB1
TrEMBLK4BND81e-154K4BND8_SOLLC; Uncharacterized protein
STRINGSolyc04g005320.2.11e-154(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.12e-84MIKC_MADS family protein